All products are for laboratory research use only. Not for human or animal consumption.

VIP 5mg

$60.00

For Research Purposes Only. Not for human consumption.

SKU: VIP5 Category:

Research Reference Data

Compound VIP (Vasoactive Intestinal Peptide)
CAS Number 40077-57-4
Molecular Formula C147H237N43O43S
Molar Mass 3325.8 g/mol
Sequence / Structure 28-aa C-terminally amidated peptide (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2)
Purity Confirmed per batch — see Certificate of Analysis
Physical Form Lyophilized powder
Storage Store lyophilized powder at -20°C, protected from light. After reconstitution, store at 2–8°C and use within the validated stability window.

For laboratory research use only. Not for human or veterinary use, food, or drug applications. Chemical identifiers describe the reference compound; exact mass, content, and purity are confirmed per batch by third-party Certificate of Analysis. [FOR LEGAL REVIEW]

Reviews

There are no reviews yet.

Be the first to review “VIP 5mg”

Your email address will not be published. Required fields are marked *

Scroll to Top