Research Reference Data
| Compound | PNC-27 |
|---|---|
| CAS Number | 1159861-00-3 |
| Molecular Formula | C188H293N53O44S |
| Molar Mass | 4031.72 g/mol |
| Sequence / Structure | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (32 aa; p53 12-26 + membrane-residency domain) |
| Purity | Confirmed per batch — see Certificate of Analysis |
| Physical Form | Lyophilized powder |
| Storage | Store lyophilized powder at -20°C, protected from light. After reconstitution, store at 2–8°C and use within the validated stability window. |
For laboratory research use only. Not for human or veterinary use, food, or drug applications. Chemical identifiers describe the reference compound; exact mass, content, and purity are confirmed per batch by third-party Certificate of Analysis. [FOR LEGAL REVIEW]



Reviews
There are no reviews yet.