All products are for laboratory research use only. Not for human or animal consumption.

PNC-27

Price range: $60.00 through $102.00

For Research Purposes Only. Not for human consumption.

SKU: N/A Category:

Research Reference Data

Compound PNC-27
CAS Number 1159861-00-3
Molecular Formula C188H293N53O44S
Molar Mass 4031.72 g/mol
Sequence / Structure PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (32 aa; p53 12-26 + membrane-residency domain)
Purity Confirmed per batch — see Certificate of Analysis
Physical Form Lyophilized powder
Storage Store lyophilized powder at -20°C, protected from light. After reconstitution, store at 2–8°C and use within the validated stability window.

For laboratory research use only. Not for human or veterinary use, food, or drug applications. Chemical identifiers describe the reference compound; exact mass, content, and purity are confirmed per batch by third-party Certificate of Analysis. [FOR LEGAL REVIEW]

Strength

5mg, 10mg

Reviews

There are no reviews yet.

Be the first to review “PNC-27”

Your email address will not be published. Required fields are marked *

Shopping Cart
Scroll to Top