Research Reference Data
| Compound | VIP (Vasoactive Intestinal Peptide) |
|---|---|
| CAS Number | 40077-57-4 |
| Molecular Formula | C147H237N43O43S |
| Molar Mass | 3325.8 g/mol |
| Sequence / Structure | 28-aa C-terminally amidated peptide (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2) |
| Purity | Confirmed per batch — see Certificate of Analysis |
| Physical Form | Lyophilized powder |
| Storage | Store lyophilized powder at -20°C, protected from light. After reconstitution, store at 2–8°C and use within the validated stability window. |
For laboratory research use only. Not for human or veterinary use, food, or drug applications. Chemical identifiers describe the reference compound; exact mass, content, and purity are confirmed per batch by third-party Certificate of Analysis. [FOR LEGAL REVIEW]





